Anti PNLDC1 pAb (ATL-HPA052026)

Atlas Antibodies

SKU: ATL-HPA052026-25

• 

Protein Description: poly(A)-specific ribonuclease (PARN)-like domain containing 1
Gene Name: PNLDC1
Alternative Gene Name: dJ195P10.2, FLJ40240
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073460: 92%, ENSRNOG00000023140: 92%
Entrez Gene ID: 154197
Uniprot ID: Q8NA58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGHNMMMDLLHLHEKFFRPLPESYDQFKQNIHSLFPVLIDTKSVTKDIWKEMNFPRVSNLSEVYEVLNSDLNPT
• Gene Sequence: VGHNMMMDLLHLHEKFFRPLPESYDQFKQNIHSLFPVLIDTKSVTKDIWKEMNFPRVSNLSEVYEVLNSDLNPT
• Gene ID - Mouse: ENSMUSG00000073460
• Gene ID - Rat: ENSRNOG00000023140
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.