Protein Description: PMS1 homolog 2, mismatch repair system component
Gene Name: PMS2
Alternative Gene Name: HNPCC4, H_DJ0042M02.9, MLH4, PMSL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079109: 58%, ENSRNOG00000001040: 48%
Entrez Gene ID: 5395
Uniprot ID: P54278
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PMS2
Alternative Gene Name: HNPCC4, H_DJ0042M02.9, MLH4, PMSL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079109: 58%, ENSRNOG00000001040: 48%
Entrez Gene ID: 5395
Uniprot ID: P54278
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MHAADLEKPMVEKQDQSPSLRTGEEKKDVSISRLREAFSLRHTTENKPHSPKTPEPRRS |
| Documents & Links for Anti PMS2 pAb (ATL-HPA070310) | |
| Datasheet | Anti PMS2 pAb (ATL-HPA070310) Datasheet (External Link) |
| Vendor Page | Anti PMS2 pAb (ATL-HPA070310) at Atlas |
| Documents & Links for Anti PMS2 pAb (ATL-HPA070310) | |
| Datasheet | Anti PMS2 pAb (ATL-HPA070310) Datasheet (External Link) |
| Vendor Page | Anti PMS2 pAb (ATL-HPA070310) |