Protein Description: polyamine-modulated factor 1
Gene Name: PMF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028066: 85%, ENSRNOG00000019620: 84%
Entrez Gene ID: 11243
Uniprot ID: Q6P1K2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PMF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028066: 85%, ENSRNOG00000019620: 84%
Entrez Gene ID: 11243
Uniprot ID: Q6P1K2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MTQQIYDKFIAQLQTSIREEISDIKEEGNLEAVLNALDKIVEEGKVRKEPAWRPSGIPEKDLHSVMAP |
| Documents & Links for Anti PMF1 pAb (ATL-HPA071854) | |
| Datasheet | Anti PMF1 pAb (ATL-HPA071854) Datasheet (External Link) |
| Vendor Page | Anti PMF1 pAb (ATL-HPA071854) at Atlas |
| Documents & Links for Anti PMF1 pAb (ATL-HPA071854) | |
| Datasheet | Anti PMF1 pAb (ATL-HPA071854) Datasheet (External Link) |
| Vendor Page | Anti PMF1 pAb (ATL-HPA071854) |