Anti PLXNA4 pAb (ATL-HPA075592)
Atlas Antibodies
- SKU:
- ATL-HPA075592-25
- Shipping:
- Calculated at Checkout
$303.00
Product Description
Protein Description: plexin A4
Gene Name: PLXNA4
Alternative Gene Name: DKFZp434G0625PRO34003, FAYV2820, KIAA1550, PLXNA4A, PLXNA4B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029765: 92%, ENSRNOG00000013072: 92%
Entrez Gene ID: 91584
Uniprot ID: Q9HCM2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PLXNA4
Alternative Gene Name: DKFZp434G0625PRO34003, FAYV2820, KIAA1550, PLXNA4A, PLXNA4B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029765: 92%, ENSRNOG00000013072: 92%
Entrez Gene ID: 91584
Uniprot ID: Q9HCM2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LNAGSNVVVMFGKQPCLFHRRSPSYIVCNTTSSDEVLEMKVSVQVDRAKIHQDLVFQYVEDPTIVRIEPEWSIVSGNTPIAVW |
Gene Sequence | LNAGSNVVVMFGKQPCLFHRRSPSYIVCNTTSSDEVLEMKVSVQVDRAKIHQDLVFQYVEDPTIVRIEPEWSIVSGNTPIAVW |
Gene ID - Mouse | ENSMUSG00000029765 |
Gene ID - Rat | ENSRNOG00000013072 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PLXNA4 pAb (ATL-HPA075592) | |
Datasheet | Anti PLXNA4 pAb (ATL-HPA075592) Datasheet (External Link) |
Vendor Page | Anti PLXNA4 pAb (ATL-HPA075592) at Atlas Antibodies |
Documents & Links for Anti PLXNA4 pAb (ATL-HPA075592) | |
Datasheet | Anti PLXNA4 pAb (ATL-HPA075592) Datasheet (External Link) |
Vendor Page | Anti PLXNA4 pAb (ATL-HPA075592) |