Anti PLXNA4 pAb (ATL-HPA075592)

Atlas Antibodies

SKU:
ATL-HPA075592-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added

Product Description

Protein Description: plexin A4
Gene Name: PLXNA4
Alternative Gene Name: DKFZp434G0625PRO34003, FAYV2820, KIAA1550, PLXNA4A, PLXNA4B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029765: 92%, ENSRNOG00000013072: 92%
Entrez Gene ID: 91584
Uniprot ID: Q9HCM2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LNAGSNVVVMFGKQPCLFHRRSPSYIVCNTTSSDEVLEMKVSVQVDRAKIHQDLVFQYVEDPTIVRIEPEWSIVSGNTPIAVW
Gene Sequence LNAGSNVVVMFGKQPCLFHRRSPSYIVCNTTSSDEVLEMKVSVQVDRAKIHQDLVFQYVEDPTIVRIEPEWSIVSGNTPIAVW
Gene ID - Mouse ENSMUSG00000029765
Gene ID - Rat ENSRNOG00000013072
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PLXNA4 pAb (ATL-HPA075592)
Datasheet Anti PLXNA4 pAb (ATL-HPA075592) Datasheet (External Link)
Vendor Page Anti PLXNA4 pAb (ATL-HPA075592) at Atlas Antibodies

Documents & Links for Anti PLXNA4 pAb (ATL-HPA075592)
Datasheet Anti PLXNA4 pAb (ATL-HPA075592) Datasheet (External Link)
Vendor Page Anti PLXNA4 pAb (ATL-HPA075592)