Anti PLXNA4 pAb (ATL-HPA052141)

Atlas Antibodies

Catalog No.:
ATL-HPA052141-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: plexin A4
Gene Name: PLXNA4
Alternative Gene Name: DKFZp434G0625PRO34003, FAYV2820, KIAA1550, PLXNA4A, PLXNA4B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029765: 100%, ENSRNOG00000013072: 100%
Entrez Gene ID: 91584
Uniprot ID: Q9HCM2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IRAKHGGKEHINICEVLNATEMTCQAPALALGPDHQSDLTERPEEFGFILDNVQSLLILNKTNFTYYPNPV
Gene Sequence IRAKHGGKEHINICEVLNATEMTCQAPALALGPDHQSDLTERPEEFGFILDNVQSLLILNKTNFTYYPNPV
Gene ID - Mouse ENSMUSG00000029765
Gene ID - Rat ENSRNOG00000013072
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLXNA4 pAb (ATL-HPA052141)
Datasheet Anti PLXNA4 pAb (ATL-HPA052141) Datasheet (External Link)
Vendor Page Anti PLXNA4 pAb (ATL-HPA052141) at Atlas Antibodies

Documents & Links for Anti PLXNA4 pAb (ATL-HPA052141)
Datasheet Anti PLXNA4 pAb (ATL-HPA052141) Datasheet (External Link)
Vendor Page Anti PLXNA4 pAb (ATL-HPA052141)