Anti PLSCR5 pAb (ATL-HPA047249)

Atlas Antibodies

SKU:
ATL-HPA047249-25
  • Immunohistochemical staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: phospholipid scramblase family, member 5
Gene Name: PLSCR5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000095654: 90%, ENSRNOG00000047917: 90%
Entrez Gene ID: 389158
Uniprot ID: A0PG75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGPCVTCGCFGDVDFEVKTINEKLTIGKISKYWSGFVNDVFTNADNFGIHVAADLDVT
Gene Sequence VGPCVTCGCFGDVDFEVKTINEKLTIGKISKYWSGFVNDVFTNADNFGIHVAADLDVT
Gene ID - Mouse ENSMUSG00000095654
Gene ID - Rat ENSRNOG00000047917
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PLSCR5 pAb (ATL-HPA047249)
Datasheet Anti PLSCR5 pAb (ATL-HPA047249) Datasheet (External Link)
Vendor Page Anti PLSCR5 pAb (ATL-HPA047249) at Atlas Antibodies

Documents & Links for Anti PLSCR5 pAb (ATL-HPA047249)
Datasheet Anti PLSCR5 pAb (ATL-HPA047249) Datasheet (External Link)
Vendor Page Anti PLSCR5 pAb (ATL-HPA047249)