Anti PLSCR5 pAb (ATL-HPA047249)
Atlas Antibodies
- SKU:
- ATL-HPA047249-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PLSCR5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000095654: 90%, ENSRNOG00000047917: 90%
Entrez Gene ID: 389158
Uniprot ID: A0PG75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VGPCVTCGCFGDVDFEVKTINEKLTIGKISKYWSGFVNDVFTNADNFGIHVAADLDVT |
Gene Sequence | VGPCVTCGCFGDVDFEVKTINEKLTIGKISKYWSGFVNDVFTNADNFGIHVAADLDVT |
Gene ID - Mouse | ENSMUSG00000095654 |
Gene ID - Rat | ENSRNOG00000047917 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PLSCR5 pAb (ATL-HPA047249) | |
Datasheet | Anti PLSCR5 pAb (ATL-HPA047249) Datasheet (External Link) |
Vendor Page | Anti PLSCR5 pAb (ATL-HPA047249) at Atlas Antibodies |
Documents & Links for Anti PLSCR5 pAb (ATL-HPA047249) | |
Datasheet | Anti PLSCR5 pAb (ATL-HPA047249) Datasheet (External Link) |
Vendor Page | Anti PLSCR5 pAb (ATL-HPA047249) |