Protein Description: phospholipid scramblase 3
Gene Name: PLSCR3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019461: 94%, ENSRNOG00000027914: 91%
Entrez Gene ID: 57048
Uniprot ID: Q9NRY6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PLSCR3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019461: 94%, ENSRNOG00000027914: 91%
Entrez Gene ID: 57048
Uniprot ID: Q9NRY6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFG |
| Documents & Links for Anti PLSCR3 pAb (ATL-HPA068609) | |
| Datasheet | Anti PLSCR3 pAb (ATL-HPA068609) Datasheet (External Link) |
| Vendor Page | Anti PLSCR3 pAb (ATL-HPA068609) at Atlas |
| Documents & Links for Anti PLSCR3 pAb (ATL-HPA068609) | |
| Datasheet | Anti PLSCR3 pAb (ATL-HPA068609) Datasheet (External Link) |
| Vendor Page | Anti PLSCR3 pAb (ATL-HPA068609) |