Anti PLPPR3 pAb (ATL-HPA052293)

Atlas Antibodies

SKU: ATL-HPA052293-25

• 

Protein Description: phospholipid phosphatase related 3
Gene Name: PLPPR3
Alternative Gene Name: FLJ11535, LPPR3, PRG-2, PRG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042002: 35%, ENSRNOG00000011752: 33%
Entrez Gene ID: 79948
Uniprot ID: Q6T4P5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VYVSVSPAPHCPSQALLLTRGEPSLTPTPMPQMYFNSVISDTT
• Gene Sequence: VYVSVSPAPHCPSQALLLTRGEPSLTPTPMPQMYFNSVISDTT
• Gene ID - Mouse: ENSMUSG00000042002
• Gene ID - Rat: ENSRNOG00000011752
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.