Protein Description: phospholipid phosphatase 7 (inactive)
Gene Name: PLPP7
Alternative Gene Name: C9orf67, FLJ14662, MGC12921, NET39, PPAPDC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051373: 97%, ENSRNOG00000010068: 97%
Entrez Gene ID: 84814
Uniprot ID: Q8NBV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PLPP7
Alternative Gene Name: C9orf67, FLJ14662, MGC12921, NET39, PPAPDC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051373: 97%, ENSRNOG00000010068: 97%
Entrez Gene ID: 84814
Uniprot ID: Q8NBV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GPYETSPSLLDYLTMDIYAFPAGHASRAAMVSK |
| Documents & Links for Anti PLPP7 pAb (ATL-HPA070252) | |
| Datasheet | Anti PLPP7 pAb (ATL-HPA070252) Datasheet (External Link) |
| Vendor Page | Anti PLPP7 pAb (ATL-HPA070252) at Atlas |
| Documents & Links for Anti PLPP7 pAb (ATL-HPA070252) | |
| Datasheet | Anti PLPP7 pAb (ATL-HPA070252) Datasheet (External Link) |
| Vendor Page | Anti PLPP7 pAb (ATL-HPA070252) |
| Citations for Anti PLPP7 pAb (ATL-HPA070252) – 1 Found |
| Ramirez-Martinez, Andres; Zhang, Yichi; Chen, Kenian; Kim, Jiwoong; Cenik, Bercin K; McAnally, John R; Cai, Chunyu; Shelton, John M; Huang, Jian; Brennan, Ana; Evers, Bret M; Mammen, Pradeep P A; Xu, Lin; Bassel-Duby, Rhonda; Liu, Ning; Olson, Eric N. The nuclear envelope protein Net39 is essential for muscle nuclear integrity and chromatin organization. Nature Communications. 2021;12(1):690. PubMed |