Anti PLPP1 pAb (ATL-HPA047815 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA047815-25

• 
• 

Protein Description: phospholipid phosphatase 1
Gene Name: PLPP1
Alternative Gene Name: LPP1, PAP-2a, PPAP2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021759: 65%, ENSRNOG00000009980: 62%
Entrez Gene ID: 8611
Uniprot ID: O14494
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Immunogen: DFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP
• Gene Sequence: DFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP
• Gene ID - Mouse: ENSMUSG00000021759
• Gene ID - Rat: ENSRNOG00000009980
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.