Anti PLOD1 pAb (ATL-HPA055799 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055799-25

• 

Protein Description: procollagen-lysine, 2-oxoglutarate 5-dioxygenase 1
Gene Name: PLOD1
Alternative Gene Name: LH1, LLH, PLOD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019055: 86%, ENSRNOG00000007763: 84%
Entrez Gene ID: 5351
Uniprot ID: Q02809
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FVSLFFQRLLRLHYPQKHMRLFIHNHEQHHKAQVEEFLAQHGSEYQSVKLVGPEVRMANADARN
• Gene Sequence: FVSLFFQRLLRLHYPQKHMRLFIHNHEQHHKAQVEEFLAQHGSEYQSVKLVGPEVRMANADARN
• Gene ID - Mouse: ENSMUSG00000019055
• Gene ID - Rat: ENSRNOG00000007763
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.