Anti PLK1 pAb (ATL-HPA051638)

Atlas Antibodies

SKU:
ATL-HPA051638-25
  • Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts and Leydig cells.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: polo-like kinase 1
Gene Name: PLK1
Alternative Gene Name: PLK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030867: 88%, ENSRNOG00000018815: 90%
Entrez Gene ID: 5347
Uniprot ID: P53350
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPERPREKEEPVVRETGEVVDCHLSDMLQQLHSVNA
Gene Sequence RPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPERPREKEEPVVRETGEVVDCHLSDMLQQLHSVNA
Gene ID - Mouse ENSMUSG00000030867
Gene ID - Rat ENSRNOG00000018815
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PLK1 pAb (ATL-HPA051638)
Datasheet Anti PLK1 pAb (ATL-HPA051638) Datasheet (External Link)
Vendor Page Anti PLK1 pAb (ATL-HPA051638) at Atlas Antibodies

Documents & Links for Anti PLK1 pAb (ATL-HPA051638)
Datasheet Anti PLK1 pAb (ATL-HPA051638) Datasheet (External Link)
Vendor Page Anti PLK1 pAb (ATL-HPA051638)