Anti PLK1 pAb (ATL-HPA051638)
Atlas Antibodies
- SKU:
- ATL-HPA051638-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: PLK1
Alternative Gene Name: PLK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030867: 88%, ENSRNOG00000018815: 90%
Entrez Gene ID: 5347
Uniprot ID: P53350
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPERPREKEEPVVRETGEVVDCHLSDMLQQLHSVNA |
Gene Sequence | RPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPERPREKEEPVVRETGEVVDCHLSDMLQQLHSVNA |
Gene ID - Mouse | ENSMUSG00000030867 |
Gene ID - Rat | ENSRNOG00000018815 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PLK1 pAb (ATL-HPA051638) | |
Datasheet | Anti PLK1 pAb (ATL-HPA051638) Datasheet (External Link) |
Vendor Page | Anti PLK1 pAb (ATL-HPA051638) at Atlas Antibodies |
Documents & Links for Anti PLK1 pAb (ATL-HPA051638) | |
Datasheet | Anti PLK1 pAb (ATL-HPA051638) Datasheet (External Link) |
Vendor Page | Anti PLK1 pAb (ATL-HPA051638) |