Anti PLIN3 pAb (ATL-HPA066538 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA066538-25

• 
• 
• 

Product Description

Protein Description: perilipin 3
Gene Name: PLIN3
Alternative Gene Name: M6PRBP1, PP17, TIP47
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024197: 75%, ENSRNOG00000048834: 73%
Entrez Gene ID: 10226
Uniprot ID: O60664
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DKTKSVVTGGVQSVMGSRLGQMVLSGVDTVLGKSEEWADNHLPLTDAELARIATSLDGFDVASVQQQRQEQ
• Gene Sequence: DKTKSVVTGGVQSVMGSRLGQMVLSGVDTVLGKSEEWADNHLPLTDAELARIATSLDGFDVASVQQQRQEQ
• Gene ID - Mouse: ENSMUSG00000024197
• Gene ID - Rat: ENSRNOG00000048834
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links