Protein Description: perilipin 3
Gene Name: PLIN3
Alternative Gene Name: M6PRBP1, PP17, TIP47
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024197: 75%, ENSRNOG00000048834: 73%
Entrez Gene ID: 10226
Uniprot ID: O60664
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PLIN3
Alternative Gene Name: M6PRBP1, PP17, TIP47
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024197: 75%, ENSRNOG00000048834: 73%
Entrez Gene ID: 10226
Uniprot ID: O60664
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DKTKSVVTGGVQSVMGSRLGQMVLSGVDTVLGKSEEWADNHLPLTDAELARIATSLDGFDVASVQQQRQEQ |
| Documents & Links for Anti PLIN3 pAb (ATL-HPA066538 w/enhanced validation) | |
| Datasheet | Anti PLIN3 pAb (ATL-HPA066538 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PLIN3 pAb (ATL-HPA066538 w/enhanced validation) at Atlas |
| Documents & Links for Anti PLIN3 pAb (ATL-HPA066538 w/enhanced validation) | |
| Datasheet | Anti PLIN3 pAb (ATL-HPA066538 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PLIN3 pAb (ATL-HPA066538 w/enhanced validation) |