Anti PLEKHH3 pAb (ATL-HPA046234)

Atlas Antibodies

SKU: ATL-HPA046234-25

• 
• 

Protein Description: pleckstrin homology domain containing, family H (with MyTH4 domain) member 3
Gene Name: PLEKHH3
Alternative Gene Name: FLJ21019
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035172: 95%, ENSRNOG00000020238: 95%
Entrez Gene ID: 79990
Uniprot ID: Q7Z736
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RYWQLLTCMSCTFRPGGAVQGHLLGHLERTEQALPDSEPAEYARFIRKALGRTRGRELVPSLAEISALSQRQELLCTVHCPGAGACAVAIDS
• Gene Sequence: RYWQLLTCMSCTFRPGGAVQGHLLGHLERTEQALPDSEPAEYARFIRKALGRTRGRELVPSLAEISALSQRQELLCTVHCPGAGACAVAIDS
• Gene ID - Mouse: ENSMUSG00000035172
• Gene ID - Rat: ENSRNOG00000020238
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.