Anti PLEKHG7 pAb (ATL-HPA060632)

Atlas Antibodies

SKU: ATL-HPA060632-25

• 

Product Description

Protein Description: pleckstrin homology domain containing, family G (with RhoGef domain) member 7
Gene Name: PLEKHG7
Alternative Gene Name: FLJ46688
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064120: 23%, ENSRNOG00000047165: 22%
Entrez Gene ID: 440107
Uniprot ID: Q6ZR37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IKEGGSCTVLDQPIPLDRLVVKSIEPLHVSVFGLRNAFLIQHENRYRQCIAAFLLQAQTENIKKTWMAQITTAISCFTKSQETKKI
• Gene Sequence: IKEGGSCTVLDQPIPLDRLVVKSIEPLHVSVFGLRNAFLIQHENRYRQCIAAFLLQAQTENIKKTWMAQITTAISCFTKSQETKKI
• Gene ID - Mouse: ENSMUSG00000064120
• Gene ID - Rat: ENSRNOG00000047165
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links