Anti PLEKHG4B pAb (ATL-HPA058157)

Atlas Antibodies

Catalog No.:
ATL-HPA058157-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: pleckstrin homology domain containing, family G (with RhoGef domain) member 4B
Gene Name: PLEKHG4B
Alternative Gene Name: KIAA1909
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059820: 29%, ENSRNOG00000009958: 29%
Entrez Gene ID: 153478
Uniprot ID: Q96PX9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HLEDSSACSSEPTQTLASRPRKHPQKKMIKKTQSFEIPQPDSGPRDSCQPDHTSVFSKGLEVTSTVATEKKLPLWQHARSP
Gene Sequence HLEDSSACSSEPTQTLASRPRKHPQKKMIKKTQSFEIPQPDSGPRDSCQPDHTSVFSKGLEVTSTVATEKKLPLWQHARSP
Gene ID - Mouse ENSMUSG00000059820
Gene ID - Rat ENSRNOG00000009958
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PLEKHG4B pAb (ATL-HPA058157)
Datasheet Anti PLEKHG4B pAb (ATL-HPA058157) Datasheet (External Link)
Vendor Page Anti PLEKHG4B pAb (ATL-HPA058157) at Atlas Antibodies

Documents & Links for Anti PLEKHG4B pAb (ATL-HPA058157)
Datasheet Anti PLEKHG4B pAb (ATL-HPA058157) Datasheet (External Link)
Vendor Page Anti PLEKHG4B pAb (ATL-HPA058157)