Anti PLEKHG2 pAb (ATL-HPA048054)

Atlas Antibodies

SKU:
ATL-HPA048054-25
  • Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in subset of hematopoietic cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: pleckstrin homology domain containing, family G (with RhoGef domain) member 2
Gene Name: PLEKHG2
Alternative Gene Name: ARHGEF42, CLG, FLJ00018
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037552: 35%, ENSRNOG00000030266: 34%
Entrez Gene ID: 64857
Uniprot ID: Q9H7P9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PATTPLPEHKSHMVIPAPSTAFCPEQGHCADIHVPTTPALPKEICSDFTVSVTTPVPKQEGHLDSESPTNIPLTKQGGSRDVQGPDPVCSQPIQPLSWHGSSLDPQGPGDTLPPLPCHLPD
Gene Sequence PATTPLPEHKSHMVIPAPSTAFCPEQGHCADIHVPTTPALPKEICSDFTVSVTTPVPKQEGHLDSESPTNIPLTKQGGSRDVQGPDPVCSQPIQPLSWHGSSLDPQGPGDTLPPLPCHLPD
Gene ID - Mouse ENSMUSG00000037552
Gene ID - Rat ENSRNOG00000030266
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PLEKHG2 pAb (ATL-HPA048054)
Datasheet Anti PLEKHG2 pAb (ATL-HPA048054) Datasheet (External Link)
Vendor Page Anti PLEKHG2 pAb (ATL-HPA048054) at Atlas Antibodies

Documents & Links for Anti PLEKHG2 pAb (ATL-HPA048054)
Datasheet Anti PLEKHG2 pAb (ATL-HPA048054) Datasheet (External Link)
Vendor Page Anti PLEKHG2 pAb (ATL-HPA048054)