Anti PLEKHD1 pAb (ATL-HPA051875)

Atlas Antibodies

SKU: ATL-HPA051875-25

• 

Protein Description: pleckstrin homology domain containing, family D (with coiled-coil domains) member 1
Gene Name: PLEKHD1
Alternative Gene Name: UPF0639
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066438: 99%, ENSRNOG00000038297: 99%
Entrez Gene ID: 400224
Uniprot ID: A6NEE1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PYAMKISHQDFHGNILLAAESEFEQTQWLEMLQESGKVTWKNAQLGEAMIKSLEAQGLQLAKEKQEYLDKLMEETEELCLQREQR
• Gene Sequence: PYAMKISHQDFHGNILLAAESEFEQTQWLEMLQESGKVTWKNAQLGEAMIKSLEAQGLQLAKEKQEYLDKLMEETEELCLQREQR
• Gene ID - Mouse: ENSMUSG00000066438
• Gene ID - Rat: ENSRNOG00000038297
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.