Protein Description: pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 8
Gene Name: PLEKHA8
Alternative Gene Name: FAPP2, MGC3358
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005225: 85%, ENSRNOG00000009971: 78%
Entrez Gene ID: 84725
Uniprot ID: Q96JA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PLEKHA8
Alternative Gene Name: FAPP2, MGC3358
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005225: 85%, ENSRNOG00000009971: 78%
Entrez Gene ID: 84725
Uniprot ID: Q96JA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TSELLYRTPPGSPQLAMLKSSKMKHPIIPIHNSLERQMELSTCENGSLNMEINGEEEILMKNKNSLYLKSAEIDCSISSEENTDDNITVQGEIMK |
Documents & Links for Anti PLEKHA8 pAb (ATL-HPA072314) | |
Datasheet | Anti PLEKHA8 pAb (ATL-HPA072314) Datasheet (External Link) |
Vendor Page | Anti PLEKHA8 pAb (ATL-HPA072314) at Atlas |
Documents & Links for Anti PLEKHA8 pAb (ATL-HPA072314) | |
Datasheet | Anti PLEKHA8 pAb (ATL-HPA072314) Datasheet (External Link) |
Vendor Page | Anti PLEKHA8 pAb (ATL-HPA072314) |