Anti PLEKHA6 pAb (ATL-HPA054311)

Atlas Antibodies

SKU:
ATL-HPA054311-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to cell junctions.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: pleckstrin homology domain containing, family A member 6
Gene Name: PLEKHA6
Alternative Gene Name: KIAA0969, PEPP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041757: 91%, ENSRNOG00000016877: 29%
Entrez Gene ID: 22874
Uniprot ID: Q9Y2H5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDKRHAFRNGGGPAYQLREWKEPASYGRQDATVWIPSPSRQPVYYDELDAASSSLRRLSLQPRSHSVPRSPSQGSYSRARIYSPVRSPSARF
Gene Sequence EDKRHAFRNGGGPAYQLREWKEPASYGRQDATVWIPSPSRQPVYYDELDAASSSLRRLSLQPRSHSVPRSPSQGSYSRARIYSPVRSPSARF
Gene ID - Mouse ENSMUSG00000041757
Gene ID - Rat ENSRNOG00000016877
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PLEKHA6 pAb (ATL-HPA054311)
Datasheet Anti PLEKHA6 pAb (ATL-HPA054311) Datasheet (External Link)
Vendor Page Anti PLEKHA6 pAb (ATL-HPA054311) at Atlas Antibodies

Documents & Links for Anti PLEKHA6 pAb (ATL-HPA054311)
Datasheet Anti PLEKHA6 pAb (ATL-HPA054311) Datasheet (External Link)
Vendor Page Anti PLEKHA6 pAb (ATL-HPA054311)