Anti PLEKHA4 pAb (ATL-HPA048473)

Atlas Antibodies

SKU: ATL-HPA048473-25

• 
• 

Protein Description: pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 4
Gene Name: PLEKHA4
Alternative Gene Name: PEPP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040428: 84%, ENSRNOG00000020942: 84%
Entrez Gene ID: 57664
Uniprot ID: Q9H4M7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RTQAHSGSPTYLQLPPRPPGTRASMVLLPGPPLESTFHQSLETDTLLTKLCGQDRLLRRLQEEIDQKQEEKEQLEAALELTRQQLGQA
• Gene Sequence: RTQAHSGSPTYLQLPPRPPGTRASMVLLPGPPLESTFHQSLETDTLLTKLCGQDRLLRRLQEEIDQKQEEKEQLEAALELTRQQLGQA
• Gene ID - Mouse: ENSMUSG00000040428
• Gene ID - Rat: ENSRNOG00000020942
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.