Anti PLD4 pAb (ATL-HPA051512)
Atlas Antibodies
- SKU:
- ATL-HPA051512-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PLD4
Alternative Gene Name: C14orf175
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052160: 80%, ENSRNOG00000028566: 81%
Entrez Gene ID: 122618
Uniprot ID: Q96BZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AQDLEKTFQTYWVLGVPKAVLPKTWPQNFSSHFNRFQPFHGLFDGVPTTAYFSASPPALCPQGRTRDLEALLAVMGSAQEFIYASVMEYFP |
Gene Sequence | AQDLEKTFQTYWVLGVPKAVLPKTWPQNFSSHFNRFQPFHGLFDGVPTTAYFSASPPALCPQGRTRDLEALLAVMGSAQEFIYASVMEYFP |
Gene ID - Mouse | ENSMUSG00000052160 |
Gene ID - Rat | ENSRNOG00000028566 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PLD4 pAb (ATL-HPA051512) | |
Datasheet | Anti PLD4 pAb (ATL-HPA051512) Datasheet (External Link) |
Vendor Page | Anti PLD4 pAb (ATL-HPA051512) at Atlas Antibodies |
Documents & Links for Anti PLD4 pAb (ATL-HPA051512) | |
Datasheet | Anti PLD4 pAb (ATL-HPA051512) Datasheet (External Link) |
Vendor Page | Anti PLD4 pAb (ATL-HPA051512) |