Protein Description: phospholipase C, eta 1
Gene Name: PLCH1
Alternative Gene Name: DKFZp434C1372, KIAA1069, MGC117152, PLCeta1, PLCL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036834: 71%, ENSRNOG00000009955: 68%
Entrez Gene ID: 23007
Uniprot ID: Q4KWH8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PLCH1
Alternative Gene Name: DKFZp434C1372, KIAA1069, MGC117152, PLCeta1, PLCL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036834: 71%, ENSRNOG00000009955: 68%
Entrez Gene ID: 23007
Uniprot ID: Q4KWH8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SLTTCEYRREGTSQLASPLKLKYNQGVVEHFQRGLRNGYCKETLRPSVPEIFNNIQDVKTQSISYLAYQGAGFVHNHFSDSDAKMFQTCVPQQS |
Gene Sequence | SLTTCEYRREGTSQLASPLKLKYNQGVVEHFQRGLRNGYCKETLRPSVPEIFNNIQDVKTQSISYLAYQGAGFVHNHFSDSDAKMFQTCVPQQS |
Gene ID - Mouse | ENSMUSG00000036834 |
Gene ID - Rat | ENSRNOG00000009955 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PLCH1 pAb (ATL-HPA036176) | |
Datasheet | Anti PLCH1 pAb (ATL-HPA036176) Datasheet (External Link) |
Vendor Page | Anti PLCH1 pAb (ATL-HPA036176) at Atlas |
Documents & Links for Anti PLCH1 pAb (ATL-HPA036176) | |
Datasheet | Anti PLCH1 pAb (ATL-HPA036176) Datasheet (External Link) |
Vendor Page | Anti PLCH1 pAb (ATL-HPA036176) |