Anti PLCB2 pAb (ATL-HPA069308 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA069308-25
  • Immunohistochemistry analysis in human bone marrow and skeletal muscle tissues using Anti-PLCB2 antibody. Corresponding PLCB2 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: phospholipase C beta 2
Gene Name: PLCB2
Alternative Gene Name: FLJ38135
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040061: 77%, ENSRNOG00000058337: 81%
Entrez Gene ID: 5330
Uniprot ID: Q00722
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PINALNSGYHHLCLHSESNMPLTMPALFIFLEMKDYIPGAWADLTVALANPIKFFSAHDTKSVKLKEAMGGLPEKPFPLASPVASQVN
Gene Sequence PINALNSGYHHLCLHSESNMPLTMPALFIFLEMKDYIPGAWADLTVALANPIKFFSAHDTKSVKLKEAMGGLPEKPFPLASPVASQVN
Gene ID - Mouse ENSMUSG00000040061
Gene ID - Rat ENSRNOG00000058337
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PLCB2 pAb (ATL-HPA069308 w/enhanced validation)
Datasheet Anti PLCB2 pAb (ATL-HPA069308 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PLCB2 pAb (ATL-HPA069308 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PLCB2 pAb (ATL-HPA069308 w/enhanced validation)
Datasheet Anti PLCB2 pAb (ATL-HPA069308 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PLCB2 pAb (ATL-HPA069308 w/enhanced validation)