Anti PLAUR pAb (ATL-HPA050843)

Atlas Antibodies

SKU:
ATL-HPA050843-25
  • Immunohistochemical staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: plasminogen activator, urokinase receptor
Gene Name: PLAUR
Alternative Gene Name: CD87, UPAR, URKR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046223: 54%, ENSRNOG00000037931: 56%
Entrez Gene ID: 5329
Uniprot ID: Q03405
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGE
Gene Sequence VRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGE
Gene ID - Mouse ENSMUSG00000046223
Gene ID - Rat ENSRNOG00000037931
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PLAUR pAb (ATL-HPA050843)
Datasheet Anti PLAUR pAb (ATL-HPA050843) Datasheet (External Link)
Vendor Page Anti PLAUR pAb (ATL-HPA050843) at Atlas Antibodies

Documents & Links for Anti PLAUR pAb (ATL-HPA050843)
Datasheet Anti PLAUR pAb (ATL-HPA050843) Datasheet (External Link)
Vendor Page Anti PLAUR pAb (ATL-HPA050843)