Anti PIWIL4 pAb (ATL-HPA057508 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA057508-25

• 
• 

Protein Description: piwi-like RNA-mediated gene silencing 4
Gene Name: PIWIL4
Alternative Gene Name: FLJ36156, HIWI2, Miwi2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036912: 53%, ENSRNOG00000009043: 49%
Entrez Gene ID: 143689
Uniprot ID: Q7Z3Z4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFMERGVKNKQDFMDLSICTREKLAHVRNCKTGS
• Gene Sequence: GRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFMERGVKNKQDFMDLSICTREKLAHVRNCKTGS
• Gene ID - Mouse: ENSMUSG00000036912
• Gene ID - Rat: ENSRNOG00000009043
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PIWIL4 pAb (ATL-HPA057508 w/enhanced validation) – 1 Found

Baumann, Bethany; Lugli, Giovanni; Gao, Shang; Zenner, Morgan; Nonn, Larisa. High levels of PIWI-interacting RNAs are present in the small RNA landscape of prostate epithelium from vitamin D clinical trial specimens. The Prostate. 2019;79(8):840-855.