Anti PITX2 pAb (ATL-HPA050074)

Atlas Antibodies

SKU: ATL-HPA050074-25

• 

Protein Description: paired-like homeodomain 2
Gene Name: PITX2
Alternative Gene Name: ARP1, Brx1, IGDS, IHG2, IRID2, Otlx2, RGS, RIEG, RIEG1, RS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028023: 95%, ENSRNOG00000010681: 31%
Entrez Gene ID: 5308
Uniprot ID: Q99697
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ACVQLGVQPAAVECLFSKDSEIKKVEFTDSPESRKEAASSKFFPRQHPGANEKDKSQQGKNEDVGAEDPSKKKR
• Gene Sequence: ACVQLGVQPAAVECLFSKDSEIKKVEFTDSPESRKEAASSKFFPRQHPGANEKDKSQQGKNEDVGAEDPSKKKR
• Gene ID - Mouse: ENSMUSG00000028023
• Gene ID - Rat: ENSRNOG00000010681
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PITX2 pAb (ATL-HPA050074) – 1 Found

Chen, Weibo; Wu, Junyi; Shi, Weiwei; Zhang, Guang; Chen, Xuemin; Ji, Anlai; Wang, Zhongxia; Wu, Junhua; Jiang, Chunping. PRRX1 deficiency induces mesenchymal-epithelial transition through PITX2/miR-200-dependent SLUG/CTNNB1 regulation in hepatocellular carcinoma. Cancer Science. 2021;112(6):2158-2172.