Anti PITPNM3 pAb (ATL-HPA059005 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA059005-25
  • Immunohistochemistry analysis in human spleen and pancreas tissues using Anti-PITPNM3 antibody. Corresponding PITPNM3 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added

Product Description

Protein Description: PITPNM family member 3
Gene Name: PITPNM3
Alternative Gene Name: ACKR6, CORD5, NIR1, RDGBA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040543: 89%, ENSRNOG00000008323: 91%
Entrez Gene ID: 83394
Uniprot ID: Q9BZ71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DLVEQIETMGKLDEHQGEGTAPCTSSILQEKQRELYRVSLRRQRFPAQGSIEIHEDSEEGCPQRSCKTHV
Gene Sequence DLVEQIETMGKLDEHQGEGTAPCTSSILQEKQRELYRVSLRRQRFPAQGSIEIHEDSEEGCPQRSCKTHV
Gene ID - Mouse ENSMUSG00000040543
Gene ID - Rat ENSRNOG00000008323
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti PITPNM3 pAb (ATL-HPA059005 w/enhanced validation)
Datasheet Anti PITPNM3 pAb (ATL-HPA059005 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PITPNM3 pAb (ATL-HPA059005 w/enhanced validation)