Anti PIP5KL1 pAb (ATL-HPA056240)

Atlas Antibodies

SKU:
ATL-HPA056240-25
  • Immunohistochemical staining of human kidney shows moderate cytoplasmic and membranous positivity in cells in tubules.
  • Immunofluorescent staining of human cell line HEK 293 shows localization to cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: phosphatidylinositol-4-phosphate 5-kinase-like 1
Gene Name: PIP5KL1
Alternative Gene Name: bA203J24.5, MGC46424
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046854: 86%, ENSRNOG00000048676: 83%
Entrez Gene ID: 138429
Uniprot ID: Q5T9C9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ISERYDIKGCEVSRWVDPAPEGSPLVLVLKDLNFQGKTINLGPQRSWFLRQMELDTTFLRELNVLDYSLLIAFQRLHE
Gene Sequence ISERYDIKGCEVSRWVDPAPEGSPLVLVLKDLNFQGKTINLGPQRSWFLRQMELDTTFLRELNVLDYSLLIAFQRLHE
Gene ID - Mouse ENSMUSG00000046854
Gene ID - Rat ENSRNOG00000048676
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PIP5KL1 pAb (ATL-HPA056240)
Datasheet Anti PIP5KL1 pAb (ATL-HPA056240) Datasheet (External Link)
Vendor Page Anti PIP5KL1 pAb (ATL-HPA056240) at Atlas Antibodies

Documents & Links for Anti PIP5KL1 pAb (ATL-HPA056240)
Datasheet Anti PIP5KL1 pAb (ATL-HPA056240) Datasheet (External Link)
Vendor Page Anti PIP5KL1 pAb (ATL-HPA056240)