Anti PIP5KL1 pAb (ATL-HPA056240)
Atlas Antibodies
- SKU:
- ATL-HPA056240-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PIP5KL1
Alternative Gene Name: bA203J24.5, MGC46424
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046854: 86%, ENSRNOG00000048676: 83%
Entrez Gene ID: 138429
Uniprot ID: Q5T9C9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ISERYDIKGCEVSRWVDPAPEGSPLVLVLKDLNFQGKTINLGPQRSWFLRQMELDTTFLRELNVLDYSLLIAFQRLHE |
Gene Sequence | ISERYDIKGCEVSRWVDPAPEGSPLVLVLKDLNFQGKTINLGPQRSWFLRQMELDTTFLRELNVLDYSLLIAFQRLHE |
Gene ID - Mouse | ENSMUSG00000046854 |
Gene ID - Rat | ENSRNOG00000048676 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PIP5KL1 pAb (ATL-HPA056240) | |
Datasheet | Anti PIP5KL1 pAb (ATL-HPA056240) Datasheet (External Link) |
Vendor Page | Anti PIP5KL1 pAb (ATL-HPA056240) at Atlas Antibodies |
Documents & Links for Anti PIP5KL1 pAb (ATL-HPA056240) | |
Datasheet | Anti PIP5KL1 pAb (ATL-HPA056240) Datasheet (External Link) |
Vendor Page | Anti PIP5KL1 pAb (ATL-HPA056240) |