Protein Description: peptidylprolyl cis/trans isomerase, NIMA-interacting 4
Gene Name: PIN4
Alternative Gene Name: EPVH, PAR14, PAR17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079480: 97%, ENSRNOG00000050051: 97%
Entrez Gene ID: 5303
Uniprot ID: Q9Y237
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PIN4
Alternative Gene Name: EPVH, PAR14, PAR17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079480: 97%, ENSRNOG00000050051: 97%
Entrez Gene ID: 5303
Uniprot ID: Q9Y237
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVE |
Documents & Links for Anti PIN4 pAb (ATL-HPA064504 w/enhanced validation) | |
Datasheet | Anti PIN4 pAb (ATL-HPA064504 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PIN4 pAb (ATL-HPA064504 w/enhanced validation) at Atlas |
Documents & Links for Anti PIN4 pAb (ATL-HPA064504 w/enhanced validation) | |
Datasheet | Anti PIN4 pAb (ATL-HPA064504 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PIN4 pAb (ATL-HPA064504 w/enhanced validation) |