Anti PIN4 pAb (ATL-HPA064504 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA064504-100

• 
• 

Product Description

Protein Description: peptidylprolyl cis/trans isomerase, NIMA-interacting 4
Gene Name: PIN4
Alternative Gene Name: EPVH, PAR14, PAR17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079480: 97%, ENSRNOG00000050051: 97%
Entrez Gene ID: 5303
Uniprot ID: Q9Y237
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVE
• Gene Sequence: LKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVE
• Gene ID - Mouse: ENSMUSG00000079480
• Gene ID - Rat: ENSRNOG00000050051
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links