Anti PILRB pAb (ATL-HPA026750)

Atlas Antibodies

SKU: ATL-HPA026750-25

• 
• 

Protein Description: paired immunoglobin-like type 2 receptor beta
Gene Name: PILRB
Alternative Gene Name: FDFACT1, FDFACT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034312: 27%, ENSRNOG00000008622: 25%
Entrez Gene ID: 29990
Uniprot ID: Q9UKJ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AGHPEIGEAAVAVHQGDQTHHHPGCHNHHHLEAQQHNHHSRPQGHRKQRALRIMAPKSGHCHQGCIGCRCAQNCHFGTAVPPPPVVEEKER
• Gene Sequence: AGHPEIGEAAVAVHQGDQTHHHPGCHNHHHLEAQQHNHHSRPQGHRKQRALRIMAPKSGHCHQGCIGCRCAQNCHFGTAVPPPPVVEEKER
• Gene ID - Mouse: ENSMUSG00000034312
• Gene ID - Rat: ENSRNOG00000008622
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.