Anti PILRA pAb (ATL-HPA056132)
Atlas Antibodies
- SKU:
- ATL-HPA056132-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PILRA
Alternative Gene Name: FDF03
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000089922: 50%, ENSRNOG00000033017: 57%
Entrez Gene ID: 29992
Uniprot ID: Q9UKJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ALSSSTSPRAPPSHRPLKSPQNETLYSVLK |
Gene Sequence | ALSSSTSPRAPPSHRPLKSPQNETLYSVLK |
Gene ID - Mouse | ENSMUSG00000089922 |
Gene ID - Rat | ENSRNOG00000033017 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PILRA pAb (ATL-HPA056132) | |
Datasheet | Anti PILRA pAb (ATL-HPA056132) Datasheet (External Link) |
Vendor Page | Anti PILRA pAb (ATL-HPA056132) at Atlas Antibodies |
Documents & Links for Anti PILRA pAb (ATL-HPA056132) | |
Datasheet | Anti PILRA pAb (ATL-HPA056132) Datasheet (External Link) |
Vendor Page | Anti PILRA pAb (ATL-HPA056132) |