Anti PILRA pAb (ATL-HPA056132)

Atlas Antibodies

SKU: ATL-HPA056132-25

• 

Protein Description: paired immunoglobin-like type 2 receptor alpha
Gene Name: PILRA
Alternative Gene Name: FDF03
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000089922: 50%, ENSRNOG00000033017: 57%
Entrez Gene ID: 29992
Uniprot ID: Q9UKJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALSSSTSPRAPPSHRPLKSPQNETLYSVLK
• Gene Sequence: ALSSSTSPRAPPSHRPLKSPQNETLYSVLK
• Gene ID - Mouse: ENSMUSG00000089922
• Gene ID - Rat: ENSRNOG00000033017
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.