Anti PIK3R5 pAb (ATL-HPA052412)

Atlas Antibodies

SKU:
ATL-HPA052412-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & microtubule organizing center.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: phosphoinositide-3-kinase, regulatory subunit 5
Gene Name: PIK3R5
Alternative Gene Name: p101, P101-PI3K
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020901: 93%, ENSRNOG00000023428: 92%
Entrez Gene ID: 23533
Uniprot ID: Q8WYR1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AISGRSRWSNLEKVCTSVNLNKACRKQEELDSSMEALTLNLTEVVKRQNSKSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPCYKP
Gene Sequence AISGRSRWSNLEKVCTSVNLNKACRKQEELDSSMEALTLNLTEVVKRQNSKSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPCYKP
Gene ID - Mouse ENSMUSG00000020901
Gene ID - Rat ENSRNOG00000023428
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PIK3R5 pAb (ATL-HPA052412)
Datasheet Anti PIK3R5 pAb (ATL-HPA052412) Datasheet (External Link)
Vendor Page Anti PIK3R5 pAb (ATL-HPA052412) at Atlas Antibodies

Documents & Links for Anti PIK3R5 pAb (ATL-HPA052412)
Datasheet Anti PIK3R5 pAb (ATL-HPA052412) Datasheet (External Link)
Vendor Page Anti PIK3R5 pAb (ATL-HPA052412)