Anti PIK3CG pAb (ATL-HPA069976)

Atlas Antibodies

SKU:
ATL-HPA069976-25
  • Immunofluorescent staining of human cell line HUVEC TERT2 shows localization to plasma membrane.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit gamma
Gene Name: PIK3CG
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020573: 93%, ENSRNOG00000009385: 93%
Entrez Gene ID: 5294
Uniprot ID: P48736
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KGKVQLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPT
Gene Sequence KGKVQLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPT
Gene ID - Mouse ENSMUSG00000020573
Gene ID - Rat ENSRNOG00000009385
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PIK3CG pAb (ATL-HPA069976)
Datasheet Anti PIK3CG pAb (ATL-HPA069976) Datasheet (External Link)
Vendor Page Anti PIK3CG pAb (ATL-HPA069976) at Atlas Antibodies

Documents & Links for Anti PIK3CG pAb (ATL-HPA069976)
Datasheet Anti PIK3CG pAb (ATL-HPA069976) Datasheet (External Link)
Vendor Page Anti PIK3CG pAb (ATL-HPA069976)