Anti PIK3CD pAb (ATL-HPA044953 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA044953-25
  • Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using HPA044953 antibody. Corresponding PIK3CD RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytokinetic bridge & vesicles.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Tonsil tissue
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit delta
Gene Name: PIK3CD
Alternative Gene Name: p110D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039936: 82%, ENSRNOG00000056810: 34%
Entrez Gene ID: 5293
Uniprot ID: O00329
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AECSRLLQILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWN
Gene Sequence AECSRLLQILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWN
Gene ID - Mouse ENSMUSG00000039936
Gene ID - Rat ENSRNOG00000056810
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti PIK3CD pAb (ATL-HPA044953 w/enhanced validation)
Datasheet Anti PIK3CD pAb (ATL-HPA044953 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PIK3CD pAb (ATL-HPA044953 w/enhanced validation)