Anti PIGZ pAb (ATL-HPA059920)

Atlas Antibodies

SKU: ATL-HPA059920-25

• 

Protein Description: phosphatidylinositol glycan anchor biosynthesis, class Z
Gene Name: PIGZ
Alternative Gene Name: FLJ12768, MGC52163, SMP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045625: 80%, ENSRNOG00000047082: 78%
Entrez Gene ID: 80235
Uniprot ID: Q86VD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: APVEVVDMGGTEDWALCQTLKSFTRQPACQVAGGPWLCRLFVVTPGTTRRAVEKCSFPFKNETLLFPHLTLEDPPALSSL
• Gene Sequence: APVEVVDMGGTEDWALCQTLKSFTRQPACQVAGGPWLCRLFVVTPGTTRRAVEKCSFPFKNETLLFPHLTLEDPPALSSL
• Gene ID - Mouse: ENSMUSG00000045625
• Gene ID - Rat: ENSRNOG00000047082
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.