Anti PIGU pAb (ATL-HPA046766)

Atlas Antibodies

SKU: ATL-HPA046766-25

• 
• 

Protein Description: phosphatidylinositol glycan anchor biosynthesis, class U
Gene Name: PIGU
Alternative Gene Name: bA346K17.2, CDC91L1, GAB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038383: 98%, ENSRNOG00000025181: 87%
Entrez Gene ID: 128869
Uniprot ID: Q9H490
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LAEFISERVEVVSPLSSWKRVVEGLSLLDLGVSPYSGAVFHETPL
• Gene Sequence: LAEFISERVEVVSPLSSWKRVVEGLSLLDLGVSPYSGAVFHETPL
• Gene ID - Mouse: ENSMUSG00000038383
• Gene ID - Rat: ENSRNOG00000025181
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.