Anti PIGM pAb (ATL-HPA047418)

Atlas Antibodies

SKU: ATL-HPA047418-25

• 

Protein Description: phosphatidylinositol glycan anchor biosynthesis, class M
Gene Name: PIGM
Alternative Gene Name: GPI-MT-I
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050229: 95%, ENSRNOG00000060604: 95%
Entrez Gene ID: 93183
Uniprot ID: Q9H3S5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QDRTLHVRYTDIDYQVFTDAARFVTEGRSPYLRATYRYT
• Gene Sequence: QDRTLHVRYTDIDYQVFTDAARFVTEGRSPYLRATYRYT
• Gene ID - Mouse: ENSMUSG00000050229
• Gene ID - Rat: ENSRNOG00000060604
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.