Anti PID1 pAb (ATL-HPA036103)

Atlas Antibodies

SKU: ATL-HPA036103-25

• 
• 

Protein Description: phosphotyrosine interaction domain containing 1
Gene Name: PID1
Alternative Gene Name: FLJ20701, NYGGF4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045658: 93%, ENSRNOG00000029735: 93%
Entrez Gene ID: 55022
Uniprot ID: Q7Z2X4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAHAMMEAFRKTFHSMKSDGRIHSNSSSEEVSQELESDDG
• Gene Sequence: VSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAHAMMEAFRKTFHSMKSDGRIHSNSSSEEVSQELESDDG
• Gene ID - Mouse: ENSMUSG00000045658
• Gene ID - Rat: ENSRNOG00000029735
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PID1 pAb (ATL-HPA036103) – 2 Found

Bonala, Sabeera; McFarlane, Craig; Ang, Jackie; Lim, Radiance; Lee, Marcus; Chua, Hillary; Lokireddy, Sudarsanareddy; Sreekanth, Patnam; Leow, Melvin Khee Shing; Meng, Khoo Chin; Shyong, Tai E; Lee, Yung Seng; Gluckman, Peter D; Sharma, Mridula; Kambadur, Ravi. Pid1 induces insulin resistance in both human and mouse skeletal muscle during obesity. Molecular Endocrinology (Baltimore, Md.). 2013;27(9):1518-35. 

Xu, Jingying; Ren, Xiuhai; Pathania, Anup Singh; Fernandez, G Esteban; Tran, Anthony; Zhang, Yifu; Moats, Rex A; Shackleford, Gregory M; Erdreich-Epstein, Anat. PID1 increases chemotherapy-induced apoptosis in medulloblastoma and glioblastoma cells in a manner that involves NFκB. Scientific Reports. 2017;7(1):835.