Protein Description: paired-like homeobox 2a
Gene Name: PHOX2A
Alternative Gene Name: ARIX, CFEOM2, FEOM2, PMX2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007946: 97%, ENSRNOG00000019706: 97%
Entrez Gene ID: 401
Uniprot ID: O14813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PHOX2A
Alternative Gene Name: ARIX, CFEOM2, FEOM2, PMX2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007946: 97%, ENSRNOG00000019706: 97%
Entrez Gene ID: 401
Uniprot ID: O14813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AAELLKAWQPAESGPGPFSGVLSSFHRKPGPALKTNLF |
| Documents & Links for Anti PHOX2A pAb (ATL-HPA065621) | |
| Datasheet | Anti PHOX2A pAb (ATL-HPA065621) Datasheet (External Link) |
| Vendor Page | Anti PHOX2A pAb (ATL-HPA065621) at Atlas |
| Documents & Links for Anti PHOX2A pAb (ATL-HPA065621) | |
| Datasheet | Anti PHOX2A pAb (ATL-HPA065621) Datasheet (External Link) |
| Vendor Page | Anti PHOX2A pAb (ATL-HPA065621) |