Anti PHOX2A pAb (ATL-HPA053810)

Atlas Antibodies

SKU: ATL-HPA053810-25

• 

Protein Description: paired like homeobox 2a
Gene Name: PHOX2A
Alternative Gene Name: ARIX, CFEOM2, FEOM2, PMX2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007946: 100%, ENSRNOG00000019706: 100%
Entrez Gene ID: 401
Uniprot ID: O14813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPY
• Gene Sequence: SYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPY
• Gene ID - Mouse: ENSMUSG00000007946
• Gene ID - Rat: ENSRNOG00000019706
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.