Protein Description: phosphorylase kinase, gamma 2 (testis)
Gene Name: PHKG2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030815: 94%, ENSRNOG00000018725: 92%
Entrez Gene ID: 5261
Uniprot ID: P15735
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PHKG2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030815: 94%, ENSRNOG00000018725: 92%
Entrez Gene ID: 5261
Uniprot ID: P15735
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LTAEQALQHPFFERCEGSQPWNLTPRQRFRVAVWTVLAAGRVALSTHRVRPLTKNALLRDPYALRSVRHLIDNCAFRLY |
Documents & Links for Anti PHKG2 pAb (ATL-HPA065618 w/enhanced validation) | |
Datasheet | Anti PHKG2 pAb (ATL-HPA065618 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PHKG2 pAb (ATL-HPA065618 w/enhanced validation) at Atlas |
Documents & Links for Anti PHKG2 pAb (ATL-HPA065618 w/enhanced validation) | |
Datasheet | Anti PHKG2 pAb (ATL-HPA065618 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PHKG2 pAb (ATL-HPA065618 w/enhanced validation) |