Protein Description: PHD finger protein 7
Gene Name: PHF7
Alternative Gene Name: HSPC226, NYD-SP6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021902: 94%, ENSRNOG00000018996: 95%
Entrez Gene ID: 51533
Uniprot ID: Q9BWX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PHF7
Alternative Gene Name: HSPC226, NYD-SP6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021902: 94%, ENSRNOG00000018996: 95%
Entrez Gene ID: 51533
Uniprot ID: Q9BWX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | IHIPDRDAAWELEPGAFSDLYQRYQHCDAPICLYEQGRDSFEDEGRWCLILCATCGSHGTHRDCSSLRSNSKKWECEE |
| Documents & Links for Anti PHF7 pAb (ATL-HPA070305) | |
| Datasheet | Anti PHF7 pAb (ATL-HPA070305) Datasheet (External Link) |
| Vendor Page | Anti PHF7 pAb (ATL-HPA070305) at Atlas |
| Documents & Links for Anti PHF7 pAb (ATL-HPA070305) | |
| Datasheet | Anti PHF7 pAb (ATL-HPA070305) Datasheet (External Link) |
| Vendor Page | Anti PHF7 pAb (ATL-HPA070305) |