Anti PHF23 pAb (ATL-HPA052410 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA052410-25
  • Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PHF23 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: PHD finger protein 23
Gene Name: PHF23
Alternative Gene Name: FLJ16355, MGC2941
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018572: 85%, ENSRNOG00000017657: 84%
Entrez Gene ID: 79142
Uniprot ID: Q9BUL5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MATVVGGEAPVPVLPTPPEAPRPPATVHPEGVPPADSESKEVGSTETSQDGDASSSEGEMRVMDEDIMVESGDDSWDLITCYCRKPF
Gene Sequence MATVVGGEAPVPVLPTPPEAPRPPATVHPEGVPPADSESKEVGSTETSQDGDASSSEGEMRVMDEDIMVESGDDSWDLITCYCRKPF
Gene ID - Mouse ENSMUSG00000018572
Gene ID - Rat ENSRNOG00000017657
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PHF23 pAb (ATL-HPA052410 w/enhanced validation)
Datasheet Anti PHF23 pAb (ATL-HPA052410 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PHF23 pAb (ATL-HPA052410 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PHF23 pAb (ATL-HPA052410 w/enhanced validation)
Datasheet Anti PHF23 pAb (ATL-HPA052410 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PHF23 pAb (ATL-HPA052410 w/enhanced validation)