Anti PHF10 pAb (ATL-HPA055649)

Atlas Antibodies

SKU: ATL-HPA055649-25

• 
• 

Protein Description: PHD finger protein 10
Gene Name: PHF10
Alternative Gene Name: BAF45a, FLJ10975, XAP135
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023883: 90%, ENSRNOG00000061312: 93%
Entrez Gene ID: 55274
Uniprot ID: Q8WUB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGRQKSKDKAATPRKDGPKRSVLSKSVPGYKPKVI
• Gene Sequence: GRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGRQKSKDKAATPRKDGPKRSVLSKSVPGYKPKVI
• Gene ID - Mouse: ENSMUSG00000023883
• Gene ID - Rat: ENSRNOG00000061312
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.