Anti PHACTR3 pAb (ATL-HPA051834)

Atlas Antibodies

SKU: ATL-HPA051834-25

• 

Protein Description: phosphatase and actin regulator 3
Gene Name: PHACTR3
Alternative Gene Name: C20orf101, PPP1R123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027525: 79%, ENSRNOG00000057996: 67%
Entrez Gene ID: 116154
Uniprot ID: Q96KR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLKQTTSALEKKMAGRQGREELIKKGLLEMMEQDAESKTCNPDGGPRSVQSEPPTPKSETLTSEDAQPGS
• Gene Sequence: KLKQTTSALEKKMAGRQGREELIKKGLLEMMEQDAESKTCNPDGGPRSVQSEPPTPKSETLTSEDAQPGS
• Gene ID - Mouse: ENSMUSG00000027525
• Gene ID - Rat: ENSRNOG00000057996
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.