Anti PGRMC1 pAb (ATL-HPA064724)

Atlas Antibodies

SKU: ATL-HPA064724-100

• 
• 

Protein Description: progesterone receptor membrane component 1
Gene Name: PGRMC1
Alternative Gene Name: HPR6.6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006373: 91%, ENSRNOG00000012786: 89%
Entrez Gene ID: 10857
Uniprot ID: O00264
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND
• Gene Sequence: SDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND
• Gene ID - Mouse: ENSMUSG00000006373
• Gene ID - Rat: ENSRNOG00000012786
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.