![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99438/178992/atl-hpa064724_anti-pgrmc1-pab-atl-hpa064724_60654__55042.1681134591.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG")
Protein Description: progesterone receptor membrane component 1
Gene Name: PGRMC1
Alternative Gene Name: HPR6.6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006373: 91%, ENSRNOG00000012786: 89%
Entrez Gene ID: 10857
Uniprot ID: O00264
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PGRMC1
Alternative Gene Name: HPR6.6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006373: 91%, ENSRNOG00000012786: 89%
Entrez Gene ID: 10857
Uniprot ID: O00264
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND |
| Documents & Links for Anti PGRMC1 pAb (ATL-HPA064724) | |
| Datasheet | Anti PGRMC1 pAb (ATL-HPA064724) Datasheet (External Link) |
| Vendor Page | Anti PGRMC1 pAb (ATL-HPA064724) at Atlas |
| Documents & Links for Anti PGRMC1 pAb (ATL-HPA064724) | |
| Datasheet | Anti PGRMC1 pAb (ATL-HPA064724) Datasheet (External Link) |
| Vendor Page | Anti PGRMC1 pAb (ATL-HPA064724) |