Anti PGM2L1 pAb (ATL-HPA060948)
Atlas Antibodies
- SKU:
- ATL-HPA060948-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PGM2L1
Alternative Gene Name: BM32A, FLJ32029
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030729: 100%, ENSRNOG00000017079: 100%
Entrez Gene ID: 283209
Uniprot ID: Q6PCE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GLRSAMGAGFCYINDLTVIQSTQGMYKYLERCFSDFKQRGFVVGYDTRGQVTSSCSSQRLAKLTAAV |
Gene Sequence | GLRSAMGAGFCYINDLTVIQSTQGMYKYLERCFSDFKQRGFVVGYDTRGQVTSSCSSQRLAKLTAAV |
Gene ID - Mouse | ENSMUSG00000030729 |
Gene ID - Rat | ENSRNOG00000017079 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PGM2L1 pAb (ATL-HPA060948) | |
Datasheet | Anti PGM2L1 pAb (ATL-HPA060948) Datasheet (External Link) |
Vendor Page | Anti PGM2L1 pAb (ATL-HPA060948) at Atlas Antibodies |
Documents & Links for Anti PGM2L1 pAb (ATL-HPA060948) | |
Datasheet | Anti PGM2L1 pAb (ATL-HPA060948) Datasheet (External Link) |
Vendor Page | Anti PGM2L1 pAb (ATL-HPA060948) |