Anti PGM2L1 pAb (ATL-HPA056995 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA056995-100
  • Immunohistochemistry analysis in human cerebral cortex and liver tissues using Anti-PGM2L1 antibody. Corresponding PGM2L1 RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Cerebral Cortex tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: phosphoglucomutase 2-like 1
Gene Name: PGM2L1
Alternative Gene Name: BM32A, FLJ32029
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030729: 78%, ENSRNOG00000017079: 77%
Entrez Gene ID: 283209
Uniprot ID: Q6PCE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YLETMNITLKQQLVKVYEKYGYHISKTSYFLCYEPPTIKSIFERLRNFDSPKEYPKFCGTFAILHVRDVTTGYD
Gene Sequence YLETMNITLKQQLVKVYEKYGYHISKTSYFLCYEPPTIKSIFERLRNFDSPKEYPKFCGTFAILHVRDVTTGYD
Gene ID - Mouse ENSMUSG00000030729
Gene ID - Rat ENSRNOG00000017079
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti PGM2L1 pAb (ATL-HPA056995 w/enhanced validation)
Datasheet Anti PGM2L1 pAb (ATL-HPA056995 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PGM2L1 pAb (ATL-HPA056995 w/enhanced validation)