Anti PGK1 pAb (ATL-HPA045385)
Atlas Antibodies
- SKU:
- ATL-HPA045385-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: PGK1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062070: 97%, ENSRNOG00000058249: 97%
Entrez Gene ID: 5230
Uniprot ID: P00558
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN |
Gene Sequence | IEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN |
Gene ID - Mouse | ENSMUSG00000062070 |
Gene ID - Rat | ENSRNOG00000058249 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PGK1 pAb (ATL-HPA045385) | |
Datasheet | Anti PGK1 pAb (ATL-HPA045385) Datasheet (External Link) |
Vendor Page | Anti PGK1 pAb (ATL-HPA045385) at Atlas Antibodies |
Documents & Links for Anti PGK1 pAb (ATL-HPA045385) | |
Datasheet | Anti PGK1 pAb (ATL-HPA045385) Datasheet (External Link) |
Vendor Page | Anti PGK1 pAb (ATL-HPA045385) |